Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C9orf25 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C9orf25 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170482
|
Novus Biologicals
NBP170482 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FAM219A Polyclonal specifically detects FAM219A in Human samples. It is validated for Western Blot.Specifications
| C9orf25 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 203259 | |
| Synthetic peptides corresponding to C9ORF25 The peptide sequence was selected from the middle region of C9ORF25. Peptide sequence SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bA573M23.5, C9orf25, chromosome 9 open reading frame 25, family with sequence similarity 219, member A, hypothetical protein LOC203259 | |
| FAM219A | |
| IgG | |
| Affinity Purified | |
| 18 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title