Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C9orf46 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C9orf46 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159462
|
Novus Biologicals
NBP159462 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PLGRKT Polyclonal specifically detects PLGRKT in Human samples. It is validated for Western Blot.Specifications
| C9orf46 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| AD025, C9orf46, chromosome 9 open reading frame 46,5033414D02Rik, FLJ14688, FLJ39176, MDS030, plasminogen receptor, C-terminal lysine transmembrane protein, Plg-R(KT), PLG-RKT, transmembrane protein C9orf46 | |
| PLGRKT | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B2R6W0 | |
| 55848 | |
| Synthetic peptides corresponding to C9ORF46 The peptide sequence was selected from the middle region of C9ORF46. Peptide sequence AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title