Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CAB39 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155393
Description
CAB39 Polyclonal specifically detects CAB39 in Human samples. It is validated for Western Blot.Specifications
CAB39 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
calcium binding protein 39, calcium-binding protein 39, FLJ22682, MO25CGI-66, Protein Mo25 | |
Rabbit | |
40 kDa | |
100 μL | |
Autophagy, Cancer, Signal Transduction | |
51719 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9Y376 | |
CAB39 | |
Synthetic peptides corresponding to CAB39(calcium binding protein 39) The peptide sequence was selected from the middle region of CAB39. Peptide sequence KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP. | |
Affinity purified | |
RUO | |
Primary | |
Yeast: 79%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction