Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CAB39 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CAB39 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155393
|
Novus Biologicals
NBP155393 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CAB39 Polyclonal specifically detects CAB39 in Human samples. It is validated for Western Blot.Specifications
| CAB39 | |
| Polyclonal | |
| Rabbit | |
| Autophagy, Cancer, Signal Transduction | |
| Q9Y376 | |
| 51719 | |
| Synthetic peptides corresponding to CAB39(calcium binding protein 39) The peptide sequence was selected from the middle region of CAB39. Peptide sequence KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| calcium binding protein 39, calcium-binding protein 39, FLJ22682, MO25CGI-66, Protein Mo25 | |
| CAB39 | |
| IgG | |
| Affinity Purified | |
| 40 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title