Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CABC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154749

 View more versions of this product

Catalog No. NBP154749


Add to cart

Description

Description

CABC1 Polyclonal antibody specifically detects CABC1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

CABC1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ADCK3
Synthetic peptides corresponding to CABC1(chaperone, ABC1 activity of bc1 complex homolog (S. pombe)) The peptide sequence was selected from the N terminal of CABC1. Peptide sequence FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ.
72 kDa
100 ul
Apoptosis, Protein Kinase
Primary
56997
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:100-1:2000
Q8NI60
aarF domain containing kinase 3, chaperone, ABC1 activity of bc1 complex homolog, chaperone, ABC1 activity of bc1 complex homolog (S. pombe), chaperone, ABC1 activity of bc1 complex like (S. pombe), chaperone-ABC1 (activity of bc1 complex, S.pombe)-like, Chaperone-ABC1-like, coenzyme Q8 homolog, EC 2.7.11, EC 2.7.11.-, MGC4849, mitochondrial, SCAR9
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit