Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CABC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CABC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154749
|
Novus Biologicals
NBP154749 |
100 μL |
Each of 1 for $436.00
|
|
Description
CABC1 Polyclonal specifically detects CABC1 in Human samples. It is validated for Western Blot.Specifications
CABC1 | |
Polyclonal | |
Rabbit | |
Apoptosis, Protein Kinase | |
Q8NI60 | |
56997 | |
IgG | |
Affinity Purified | |
72 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
aarF domain containing kinase 3, chaperone, ABC1 activity of bc1 complex homolog, chaperone, ABC1 activity of bc1 complex homolog (S. pombe), chaperone, ABC1 activity of bc1 complex like (S. pombe), chaperone-ABC1 (activity of bc1 complex, S.pombe)-like, Chaperone-ABC1-like, coenzyme Q8 homolog, EC 2.7.11, EC 2.7.11.-, MGC4849, mitochondrial, SCAR9 | |
Synthetic peptides corresponding to CABC1(chaperone, ABC1 activity of bc1 complex homolog (S. pombe)) The peptide sequence was selected from the N terminal of CABC1. Peptide sequence FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title