Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CACNA1G Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180105

 View more versions of this product

Catalog No. NBP180105

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

CACNA1G Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

CACNA1G
LYOPH
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 2.5 ug/ml
O43497
calcium channel, voltage-dependent, T type, alpha 1G subunit, cav3.1c, KIAA1123, voltage-dependent calcium channel alpha 1G subunit, voltage-dependent T-type calcium channel subunit alpha-1G, voltage-dependent, alpha 1G subunit, voltage-dependent, T type, alpha-1G subunit
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
8913
Human
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
CACNA1G
Synthetic peptide directed towards the middle region of human CACNA1G (NP_938202). Peptide sequence VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS.
241 kDa
50 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit