Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CACNA1G Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22

Specifications

Antigen CACNA1G
Immunogen Synthetic peptide directed towards the middle region of human CACNA1G (NP_938202). Peptide sequence VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18010520 View Documents Novus Biologicals
NBP18010520UL
20 ul Each for $152.22
Add to cart
 
NBP180105 View Documents Novus Biologicals
NBP180105
50 ul This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.
N/A
Description

Description

CACNA1G Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

CACNA1G
Rabbit
Polyclonal
Unconjugated
8913
Affinity Purified
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
RUO
Synthetic peptide directed towards the middle region of human CACNA1G (NP_938202). Peptide sequence VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS.
Primary
IgG
calcium channel, voltage-dependent, T type, alpha 1G subunit, cav3.1c, KIAA1123, voltage-dependent calcium channel alpha 1G subunit, voltage-dependent T-type calcium channel subunit alpha-1G, voltage-dependent, alpha 1G subunit, voltage-dependent, T type, alpha-1G subunit
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit