Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CACNG1 Antibody, Novus Biologicals™

Name: CACNG1 Antibody, Novus Biologicals&trade;
Brand: Novus Biologicals
SKU: NBP16899820
Price: 204.00 USD

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP16899820UL

View more versions of this product

Catalog No. NBP16899820

$204.00 / Each of 1

Qty

Add to Cart

Description

CACNG1 Polyclonal specifically detects CACNG1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	CACNG1
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Accession No.	O70578
Gene Symbols	CACNG1
Immunogen	Synthetic peptides corresponding to Cacng1 (calcium channel, voltage-dependent, gamma subunit 1) The peptide sequence was selected from the N terminal of Cacng1. Peptide sequence AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI.
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	786
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	CACNLGDihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma, calcium channel, voltage-dependent, gamma subunit 1, L-type calcium channel gamma polypeptide, neuronal dihydropyridine-sensitive calcium channel gamma subunit, voltage-dependent calcium channel gamma-1 subunit
Host Species	Rabbit
Molecular Weight of Antigen	25 kDa
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Mouse
Isotype	IgG

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

CACNG1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions