Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CACNG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP168998
Description
CACNG1 Polyclonal specifically detects CACNG1 in Mouse samples. It is validated for Western Blot.Specifications
CACNG1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CACNLGDihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma, calcium channel, voltage-dependent, gamma subunit 1, L-type calcium channel gamma polypeptide, neuronal dihydropyridine-sensitive calcium channel gamma subunit, voltage-dependent calcium channel gamma-1 subunit | |
Rabbit | |
25 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O70578 | |
CACNG1 | |
Synthetic peptides corresponding to Cacng1 (calcium channel, voltage-dependent, gamma subunit 1) The peptide sequence was selected from the N terminal of Cacng1. Peptide sequence AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI. | |
Affinity purified | |
RUO | |
786 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction