Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cadherin-22 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Cadherin-22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP160069
|
Novus Biologicals
NBP160069 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Cadherin-22 Polyclonal specifically detects Cadherin-22 in Human samples. It is validated for Western Blot.Specifications
| Cadherin-22 | |
| Polyclonal | |
| Purified | |
| RUO | |
| C20orf25, cadherin 22, type 2, cadherin-22, cadherin-like 22, dJ998H6.1, MGC39564, ortholog of rat PB-cadherin, PB-cadherin, Pituitary and brain cadherin | |
| CDH22 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 64405 | |
| Synthetic peptides corresponding to CDH22(cadherin-like 22) The peptide sequence was selected from the N terminal of CDH22. Peptide sequence LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title