Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Life Sciences
  4. Protein Biology
  5. Protein Extraction and Purification
  6. Protein Purification
  7. Protease Inhibitors and Phosphatase Inhibitors
  8. 4814182MG

MilliporeSigma™ Calbiochem™ NEMO NOA Peptide, Cell-Permeable, A-UBI

The NF-κB Activation Inhibitor VIII, A-UBI controls the biological activity of NF-κB. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.

Manufacturer:  MilliporeSigma™ 4814182MG

Catalog No. 48-141-82MG

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

  • Packaged Under Inert Gas
  • Peptide Sequence: RQIKIWFQNRRMKWKKLKAQADIYKARFQAERHAREK
Specifications

Specifications

95% by HPLC
Protect from Light
C215H347N71O50S1 plus TFA and water
H2O
White powder
2mg
4758.59g/mol
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit