Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MilliporeSigma Calbiochem NEMO NOA Peptide, Cell-Permeable, A-UBI
The NF-κB Activation Inhibitor VIII, A-UBI controls the biological activity of NF-κB. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.
Manufacturer: MilliporeSigma 4814182MG
Description
- Packaged Under Inert Gas
- Peptide Sequence: RQIKIWFQNRRMKWKKLKAQADIYKARFQAERHAREK
Specifications
95% by HPLC | |
Protect from Light | |
C215H347N71O50S1 plus TFA and water | |
H2O |
White powder | |
2mg | |
4758.59g/mol |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title