Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CALML3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CALML3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179929
|
Novus Biologicals
NBP179929 |
100 μL |
Each for $436.00
|
|
NBP17992920
|
Novus Biologicals
NBP17992920UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
CALML3 Polyclonal specifically detects CALML3 in Human samples. It is validated for Western Blot.Specifications
| CALML3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| calmodulin-like 3, calmodulin-like protein 3, CaM-like protein, CLPCalmodulin-related protein NB-1 | |
| CALML3 | |
| IgG | |
| Affinity Purified | |
| 16 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_005176 | |
| 810 | |
| The immunogen for this antibody is CALML3. Peptide sequence TVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title