Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calpain S2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Calpain S2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179818
|
Novus Biologicals
NBP179818 |
100 μL |
Each for $436.00
|
|
NBP17981820
|
Novus Biologicals
NBP17981820UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Calpain S2 Polyclonal specifically detects Calpain S2 in Human samples. It is validated for Western Blot.Specifications
Calpain S2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Calcium-dependent protease small subunit 2, calpain small subunit 2, calpain, small subunit 2, CSS2, MGC12536, MGC14804 | |
CAPNS2 | |
IgG | |
Affinity Purified | |
28 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_115706 | |
84290 | |
Synthetic peptide directed towards the N terminal of human CAPNS2. Peptide sequence GRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title