Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Calsyntenin-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Calsyntenin-1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15986220
View Documents
Novus Biologicals
NBP15986220UL
20 μL
Each for $152.22
Add to cart
 
NBP159862
View Documents
Novus Biologicals
NBP159862
100 μL
Each for $436.00
Add to cart
 
Description

Description

Calsyntenin-1 Polyclonal specifically detects Calsyntenin-1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Calsyntenin-1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
alcadein alpha 1, Alcadein-alpha, ALC-ALPHA, alcalpha1, alcalpha2, Alzheimer-related cadherin-like protein, cadherin-related family member 12, calsyntenin 1, calsyntenin-1, CDHR12, CS1, CSTN1, FLJ32258, KIAA0911alcadein-alpha, Non-classical cadherin XB31alpha, non-classical cadherin XB31alpha1, PIK3CD, XB31alpha
CLSTN1
IgG
Affinity Purified
110 kDa
Western Blot
Unconjugated
RUO
O94985
22883
Synthetic peptides corresponding to CLSTN1(calsyntenin 1) Antibody(against the N terminal of CLSTN1. Peptide sequence KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit