Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calsyntenin-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Calsyntenin-1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15986220
|
Novus Biologicals
NBP15986220UL |
20 μL |
Each for $152.22
|
|
NBP159862
|
Novus Biologicals
NBP159862 |
100 μL |
Each for $436.00
|
|
Description
Calsyntenin-1 Polyclonal specifically detects Calsyntenin-1 in Human samples. It is validated for Western Blot.Specifications
Calsyntenin-1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
alcadein alpha 1, Alcadein-alpha, ALC-ALPHA, alcalpha1, alcalpha2, Alzheimer-related cadherin-like protein, cadherin-related family member 12, calsyntenin 1, calsyntenin-1, CDHR12, CS1, CSTN1, FLJ32258, KIAA0911alcadein-alpha, Non-classical cadherin XB31alpha, non-classical cadherin XB31alpha1, PIK3CD, XB31alpha | |
CLSTN1 | |
IgG | |
Affinity Purified | |
110 kDa |
Western Blot | |
Unconjugated | |
RUO | |
O94985 | |
22883 | |
Synthetic peptides corresponding to CLSTN1(calsyntenin 1) Antibody(against the N terminal of CLSTN1. Peptide sequence KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title