Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Calsyntenin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $501.50

Specifications

Antigen	Calsyntenin-3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15971320 View Documents View Product Certificates	Novus Biologicals NBP15971320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159713 View Documents View Product Certificates	Novus Biologicals NBP159713	100 μL	Each for $501.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Calsyntenin-3 Polyclonal specifically detects Calsyntenin-3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Calsyntenin-3
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9BQT9
Gene ID (Entrez)	9746
Immunogen	Synthetic peptides corresponding to CLSTN3 (calsyntenin 3) The peptide sequence was selected from the N terminal of CLSTN3)(50ug). Peptide sequence QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	alcadein beta, Alcadein-beta, Alc-beta, cadherin-related family member 14, calsyntenin 3, calsyntenin-3, CDHR14, CS3, CSTN3, KIAA0726alcbeta, MGC131797, MGC138488
Gene Symbols	CLSTN3
Isotype	IgG
Molecular Weight of Antigen	106 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Calsyntenin-3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents