Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CaMKI gamma Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CaMKI gamma |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157827
|
Novus Biologicals
NBP157827 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CaMKI gamma Polyclonal specifically detects CaMKI gamma in Human samples. It is validated for Western Blot.Specifications
| CaMKI gamma | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| Q96NX5 | |
| 57172 | |
| Synthetic peptides corresponding to CAMK1G(calcium/calmodulin-dependent protein kinase IG) Antibody(against the N terminal of CAMK1G. Peptide sequence SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| calcium/calmodulin-dependent protein kinase IG, calcium/calmodulin-dependent protein kinase type 1G, CaM kinase I gamma, CaM kinase IG, CaMKI gamma, CaM-KI gamma, caMKIG, CaMK-like CREB kinase III, CLICKIII, dJ272L16.1, EC 2.7.11, EC 2.7.11.17, VWS1CLICK III | |
| CAMK1G | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title