Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CaMKII beta Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31063025UL

 View more versions of this product

Catalog No. NB126162


Add to cart

Description

Description

CaMKII beta Polyclonal antibody specifically detects CaMKII beta in Rat samples. It is validated for Western Blot
Specifications

Specifications

CaMKII beta
Unconjugated
PBS buffer, 2% sucrose
calcium/calmodulin-dependent protein kinase (CaM kinase) II beta, calcium/calmodulin-dependent protein kinase II beta, calcium/calmodulin-dependent protein kinase type II beta chain, calcium/calmodulin-dependent protein kinase type II subunit beta, CaM kinase II beta subunit, CaM kinase II subunit beta, CAM2CAMK2, CAMKB, CaMK-II subunit beta, CaM-kinase II beta chain, EC 2.7.11, EC 2.7.11.17, MGC29528, proline rich calmodulin-dependent protein kinase
The immunogen is a synthetic peptide directed towards the middle region of Rat CaMKII beta (NP_001035813). Peptide sequence DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG
25 μg
Protein Kinase, Wnt Signaling Pathway
Primary
816
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Rat
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit