Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$152.22 - $436.00
Specifications
| Antigen | CAP1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15832020
|
Novus Biologicals
NBP15832020UL |
20 μL |
Each for $152.22
|
|
NBP158320
|
Novus Biologicals
NBP158320 |
100 μL |
Each for $436.00
|
|
Description
CAP1 Polyclonal specifically detects CAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CAP1 | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| adenylyl cyclase-associated protein 1, CAP, adenylate cyclase-associated protein 1 (yeast), CAP1-PEN, CAPCAP 1, SSKAP55 | |
| CAP1 | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q01518 | |
| 10487 | |
| Synthetic peptides corresponding to CAP1(CAP, adenylate cyclase-associated protein 1 (yeast)) The peptide sequence was selected from the middle region of CAP1. Peptide sequence KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title