Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CAPSL Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CAPSL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179507
|
Novus Biologicals
NBP179507 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CAPSL Polyclonal specifically detects CAPSL in Rat samples. It is validated for Western Blot.Specifications
| CAPSL | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| calcyphosine-like, calcyphosin-like protein, MGC26610 | |
| CAPSL | |
| IgG | |
| Affinity Purified | |
| 24 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001099887 | |
| 133690 | |
| Synthetic peptide directed towards the C terminal of human CapslThe immunogen for this antibody is Capsl. Peptide sequence HHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASID. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title