Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carboxypeptidase B2/CPB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15792020UL
Description
Carboxypeptidase B2/CPB2 Polyclonal specifically detects Carboxypeptidase B2/CPB2 in Human samples. It is validated for Western Blot.Specifications
Carboxypeptidase B2/CPB2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96IY4 | |
CPB2 | |
Synthetic peptides corresponding to CPB2(carboxypeptidase B2 (plasma)) The peptide sequence was selected from the middle region of CPB2. Peptide sequence RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
carboxypeptidase B2, carboxypeptidase B2 (plasma), carboxypeptidase B2 (plasma, carboxypeptidase U), Carboxypeptidase U, CPUEC 3.4.17.20, EC 3.4.17, PCPB, Plasma carboxypeptidase B, TAFIcarboxypeptidase B-like protein, Thrombin-activable fibrinolysis inhibitor, thrombin-activatable fibrinolysis inhibitor | |
Rabbit | |
Affinity Purified | |
RUO | |
1361 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction