Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Casein Kinase 1 gamma Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180262

 View more versions of this product

Catalog No. NBP180262


Add to cart

Description

Description

Casein Kinase 1 gamma Polyclonal antibody specifically detects Casein Kinase 1 gamma in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Casein Kinase 1 gamma
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
CSNK1G1
Synthetic peptide directed towards the middle region of mouse CSNK1G1. Peptide sequence CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW.
Protein A purified
RUO
Primary
53944
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_775277
casein kinase 1, gamma 1, casein kinase I isoform gamma-1, CKI-gamma 1, EC 2.7.11, EC 2.7.11.1
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Human: 92%; Rat: 92%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit