Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Casein Kinase 1 gamma Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Casein Kinase 1 gamma |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180262
|
Novus Biologicals
NBP180262 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Casein Kinase 1 gamma Polyclonal specifically detects Casein Kinase 1 gamma in Mouse samples. It is validated for Western Blot.Specifications
| Casein Kinase 1 gamma | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_775277 | |
| 53944 | |
| Synthetic peptide directed towards the middle region of mouse CSNK1G1. Peptide sequence CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| casein kinase 1, gamma 1, casein kinase I isoform gamma-1, CKI-gamma 1, EC 2.7.11, EC 2.7.11.1 | |
| CSNK1G1 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title