Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin C/DPPI Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310659100UL
Description
Cathepsin C/DPPI Polyclonal specifically detects Cathepsin C/DPPI in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Cathepsin C/DPPI | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
cathepsin CEC 3.4.14.1, Cathepsin J, CPPIHMS, dipeptidyl peptidase 1, Dipeptidyl peptidase I, Dipeptidyl transferase, dipeptidyl-peptidase I, DPP1, DPPI, DPP-I, JP, JPD, PALS, PLS | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Cathepsin C/DPPI. Peptide sequence VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD | |
100 μg | |
Core ESC Like Genes, Stem Cell Markers | |
1075 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction