Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CBR4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CBR4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CBR4 Polyclonal specifically detects CBR4 in Human samples. It is validated for Western Blot.Specifications
CBR4 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
3-oxoacyl-[acyl-carrier-protein] reductase, carbonic reductase 4, carbonyl reductase 4, carbonyl reductase family member 4, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ14431, Quinone reductase CBR4, SDR45C1, short chain dehydrogenase/reductase family 45C, member 1 | |
CBR4 | |
IgG | |
25 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_116172 | |
84869 | |
The immunogen for this antibody is CBR4. Peptide sequence VGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title