Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CBR4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17986020UL

 View more versions of this product

Catalog No. NBP17986020


Add to cart

Description

Description

CBR4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CBR4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CBR4
Synthetic peptide directed towards the N terminal of human CBR4The immunogen for this antibody is CBR4. Peptide sequence RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH.
25 kDa
20ul
Lipid and Metabolism
Primary
84869
Western Blot
Western Blot 1:1000
NP_116172
3-oxoacyl-[acyl-carrier-protein] reductase, carbonic reductase 4, carbonyl reductase 4, carbonyl reductase family member 4, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ14431, Quinone reductase CBR4, SDR45C1, short chain dehydrogenase/reductase family 45C, member 1
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit