Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CC2D1B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152841

 View more versions of this product

Catalog No. NBP152841


Add to cart

Description

Description

CC2D1B Polyclonal antibody specifically detects CC2D1B in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

CC2D1B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CC2D1B
Synthetic peptides corresponding to CC2D1B(coiled-coil and C2 domain containing 1B) The peptide sequence was selected from the C terminal of CC2D1B. Peptide sequence IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF.
41 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q5T0F9
coiled-coil and C2 domain containing 1B, KIAA1836coiled-coil and C2 domain-containing protein 1B
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
200014
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit