CCBE1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179501

Catalog No. NBP179501

Description

CCBE1 Polyclonal specifically detects CCBE1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: CCBE1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_848908
• Gene Symbols: CCBE1
• Immunogen: Synthetic peptide directed towards the C terminal of human Ccbe1The immunogen for this antibody is Ccbe1. Peptide sequence RGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRTHSSAEDFP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 147372
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: collagen and calcium binding EGF domains 1, collagen and calcium-binding EGF domain-containing protein 1, Full of fluid protein homolog, KIAA1983FLJ30681, MGC50861
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 86%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG