Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCBE1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179501
Description
CCBE1 Polyclonal specifically detects CCBE1 in Mouse samples. It is validated for Western Blot.Specifications
CCBE1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_848908 | |
CCBE1 | |
Synthetic peptide directed towards the C terminal of human Ccbe1The immunogen for this antibody is Ccbe1. Peptide sequence RGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRTHSSAEDFP. | |
Affinity Purified | |
RUO | |
147372 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
collagen and calcium binding EGF domains 1, collagen and calcium-binding EGF domain-containing protein 1, Full of fluid protein homolog, KIAA1983FLJ30681, MGC50861 | |
Rabbit | |
45 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 86%; Chicken: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title