Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCBE1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CCBE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1795020
|
Novus Biologicals
NBP17950120UL |
20 μL |
Each for $152.22
|
|
NBP179501
|
Novus Biologicals
NBP179501 |
100 μL |
Each for $436.00
|
|
Description
CCBE1 Polyclonal specifically detects CCBE1 in Mouse samples. It is validated for Western Blot.Specifications
| CCBE1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| collagen and calcium binding EGF domains 1, collagen and calcium-binding EGF domain-containing protein 1, Full of fluid protein homolog, KIAA1983FLJ30681, MGC50861 | |
| CCBE1 | |
| IgG | |
| Affinity Purified | |
| 45 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_848908 | |
| 147372 | |
| Synthetic peptide directed towards the C terminal of human Ccbe1The immunogen for this antibody is Ccbe1. Peptide sequence RGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRTHSSAEDFP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title