Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC109B Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | CCDC109B |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126593
|
Novus Biologicals
NBP310846100UL |
100 μg |
Each for $482.50
|
|
|||||
|
NB126594
|
Novus Biologicals
NBP31084625UL |
25 μg | Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area. | N/A | |||||
Description
CCDC109B Polyclonal specifically detects CCDC109B in Mouse samples. It is validated for Western Blot.Specifications
| CCDC109B | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| CCDC109B coiled-coil domain containing 109B | |
| The immunogen is a synthetic peptide directed towards the middle region of mouse CCDC109B (NP_001280573.1). Peptide sequence KHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIIT | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 55013 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title