Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC11 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CCDC11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156790
|
Novus Biologicals
NBP156790 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CCDC11 Polyclonal specifically detects CCDC11 in Human samples. It is validated for Western Blot.Specifications
| CCDC11 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| coiled-coil domain containing 11, coiled-coil domain-containing protein 11, FLJ32743 | |
| CCDC11 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96M91 | |
| 220136 | |
| Synthetic peptides corresponding to CCDC11(coiled-coil domain containing 11) The peptide sequence was selected from the N terminal of CCDC11. Peptide sequence YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title