Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC110 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17959320UL

 View more versions of this product

Catalog No. NBP17959320


Add to cart

Description

Description

CCDC110 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CCDC110
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CCDC110
Synthetic peptide directed towards the middle region of human CCDC110The immunogen for this antibody is CCDC110. Peptide sequence KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ.
97 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_689988
Cancer/testis antigen 52, coiled-coil domain containing 110, coiled-coil domain-containing protein 110, CT52Cancer/testis antigen KM-HN-1, KMHN1KM-HN-1, MGC33607
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
256309
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit