Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC116 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen CCDC116
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126147
View Documents
Novus Biologicals
NBP310623100UL
100 μg
Each for $352.89
Add to cart
 
NB126148
View Documents
Novus Biologicals
NBP31062325UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

CCDC116 Polyclonal antibody specifically detects CCDC116 in Human samples. It is validated for Western Blot
Specifications

Specifications

CCDC116
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
164592
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
coiled-coil domain containing 116, coiled-coil domain-containing protein 116, FLJ36046
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC116 (NP_689825). Peptide sequence VQQEPATHTAQDQATEPCRSLYTNLPASRQLSPLEPKLYMSACTGMGSSP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit