Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC151 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CCDC151
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156716
View Documents
Novus Biologicals
NBP156716
100 μL
Each for $436.00
Add to cart
 
NBP15671620
View Documents
Novus Biologicals
NBP15671620UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

CCDC151 Polyclonal specifically detects CCDC151 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CCDC151
Polyclonal
Rabbit
Human
A5D8V7
115948
Synthetic peptides corresponding to MGC20983 The peptide sequence was selected from the middle region of MGC20983. Peptide sequence IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
coiled-coil domain containing 151, coiled-coil domain-containing protein 151, FLJ31801, MGC20983
CCDC151
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit