Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC151 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CCDC151 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156716
|
Novus Biologicals
NBP156716 |
100 μL |
Each for $436.00
|
|
NBP15671620
|
Novus Biologicals
NBP15671620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
CCDC151 Polyclonal specifically detects CCDC151 in Human samples. It is validated for Western Blot.Specifications
| CCDC151 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| A5D8V7 | |
| 115948 | |
| Synthetic peptides corresponding to MGC20983 The peptide sequence was selected from the middle region of MGC20983. Peptide sequence IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| coiled-coil domain containing 151, coiled-coil domain-containing protein 151, FLJ31801, MGC20983 | |
| CCDC151 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title