Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC25 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CCDC25 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156660
|
Novus Biologicals
NBP156660 |
100 μL |
Each of 1 for $436.00
|
|
Description
CCDC25 Polyclonal specifically detects CCDC25 in Human samples. It is validated for Western Blot.Specifications
CCDC25 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
coiled-coil domain containing 25, coiled-coil domain-containing protein 25, FLJ10853 | |
CCDC25 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q86WR0 | |
55246 | |
Synthetic peptides corresponding to CCDC25(coiled-coil domain containing 25) The peptide sequence was selected from the middle region of CCDC25. Peptide sequence DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title