Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC28A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17958120UL

 View more versions of this product

Catalog No. NBP1795820


Add to cart

Description

Description

CCDC28A Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CCDC28A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CCDC28A
Synthetic peptide directed towards the middle region of human CCDC28AThe immunogen for this antibody is CCDC28A. Peptide sequence ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE.
39 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_056254
C6orf80, CCRL1APMGC131913, chemokine C-C motif receptor-like 1 adjacent, chromosome 6 open reading frame 80, coiled-coil domain containing 28A, coiled-coil domain-containing protein 28A, DKFZp586D0623
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
25901
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit