CCDC46 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179545

Catalog No. NBP179545

Description

CCDC46 Polyclonal specifically detects CCDC46 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC46
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001032402
• Gene Symbols: CEP112
• Immunogen: Synthetic peptide directed towards the C terminal of human CCDC46The immunogen for this antibody is CCDC46. Peptide sequence IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 85%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coiled-coil domain containing 46, coiled-coil domain-containing protein 46, FLJ39610, MGC33887
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 201134
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.