Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC54 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CCDC54 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156379
|
Novus Biologicals
NBP156379 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CCDC54 Polyclonal specifically detects CCDC54 in Human samples. It is validated for Western Blot.Specifications
| CCDC54 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8NEL0 | |
| 84692 | |
| Synthetic peptides corresponding to CCDC54(coiled-coil domain containing 54) The peptide sequence was selected from the N terminal of CCDC54. Peptide sequence MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| coiled-coil domain containing 54, coiled-coil domain-containing protein 54, FLJ25362, NYD-SP17, testes development-related NYD-SP17, Testis development protein NYD-SP17 | |
| CCDC54 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title