Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC54 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CCDC54
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156379
View Documents
Novus Biologicals
NBP156379
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CCDC54 Polyclonal specifically detects CCDC54 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CCDC54
Polyclonal
Rabbit
Human
Q8NEL0
84692
Synthetic peptides corresponding to CCDC54(coiled-coil domain containing 54) The peptide sequence was selected from the N terminal of CCDC54. Peptide sequence MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
coiled-coil domain containing 54, coiled-coil domain-containing protein 54, FLJ25362, NYD-SP17, testes development-related NYD-SP17, Testis development protein NYD-SP17
CCDC54
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit