Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CCDC7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15675720
|
Novus Biologicals
NBP15675720UL |
20 μL |
Each for $152.22
|
|
NBP156757
|
Novus Biologicals
NBP156757 |
100 μL |
Each for $436.00
|
|
Description
CCDC7 Polyclonal specifically detects CCDC7 in Human samples. It is validated for Western Blot.Specifications
| CCDC7 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| BioT2-A, BioT2-B, BioT2-C, coiled-coil domain containing 7, coiled-coil domain-containing protein 7, DKFZp686N0559, FLJ32762, RP11-479G22.1 | |
| CCDC7 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96M83 | |
| 221016 | |
| Synthetic peptides corresponding to CCDC7(coiled-coil domain containing 7) The peptide sequence was selected from the N terminal of CCDC7. Peptide sequence KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title