Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC70 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CCDC70
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155305
View Documents
Novus Biologicals
NBP155305
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CCDC70 Polyclonal specifically detects CCDC70 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CCDC70
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
coiled-coil domain containing 70, coiled-coil domain-containing protein 70, DKFZP434K1172, FLJ25853
CCDC70
IgG
Affinity Purified
26 kDa
Western Blot
Unconjugated
RUO
Q6NSX1
83446
Synthetic peptides corresponding to CCDC70(coiled-coil domain containing 70) The peptide sequence was selected from the middle region of CCDC70. Peptide sequence TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit