Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC76 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC76 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC76 Polyclonal specifically detects CCDC76 in Human samples. It is validated for Western Blot.Specifications
CCDC76 | |
Polyclonal | |
Rabbit | |
Q9NUP7 | |
54482 | |
Synthetic peptides corresponding to CCDC76 (coiled-coil domain containing 76) The peptide sequence was selected from the N terminal of CCDC76. Peptide sequence QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
coiled-coil domain containing 76, Coiled-coil domain-containing protein 76, EC 2.1.1.-, FLJ10287, FLJ11219, tRNA [Gm4] methyltransferase, tRNA guanosine-2'-O-methyltransferase TRM13 homolog | |
TRMT13 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title