Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCL13/MCP-4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17993620UL

 View more versions of this product

Catalog No. NBP17993620


Add to cart

Description

Description

CCL13/MCP-4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CCL13/MCP-4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CCL13
Synthetic peptide directed towards the middle region of human CCL13. Peptide sequence KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.
11 kDa
20ul
Cancer
Primary
6357
Western Blot
Western Blot 1:1000
NP_005399
C-C motif chemokine 13, chemokine (C-C motif) ligand 13, CKb10, MCP4, MCP-4Monocyte chemoattractant protein 4, MGC17134, NCC-1Monocyte chemotactic protein 4, NCC1Small-inducible cytokine A13, new CC chemokine 1, SCYA13CK-beta-10, SCYL1, small inducible cytokine subfamily A (Cys-Cys), member 13
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit