Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCL13/MCP-4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CCL13/MCP-4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17993620
|
Novus Biologicals
NBP17993620UL |
20 μL |
Each for $152.22
|
|
NBP179936
|
Novus Biologicals
NBP179936 |
100 μL |
Each for $436.00
|
|
Description
CCL13/MCP-4 Polyclonal specifically detects CCL13/MCP-4 in Human samples. It is validated for Western Blot.Specifications
| CCL13/MCP-4 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C-C motif chemokine 13, chemokine (C-C motif) ligand 13, CKb10, MCP4, MCP-4Monocyte chemoattractant protein 4, MGC17134, NCC-1Monocyte chemotactic protein 4, NCC1Small-inducible cytokine A13, new CC chemokine 1, SCYA13CK-beta-10, SCYL1, small inducible cytokine subfamily A (Cys-Cys), member 13 | |
| CCL13 | |
| IgG | |
| Affinity Purified | |
| 11 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| NP_005399 | |
| 6357 | |
| Synthetic peptide directed towards the middle region of human CCL13. Peptide sequence KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title