Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCNB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18012720UL
Description
CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.Specifications
CCNB3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_391990 | |
CCNB3 | |
Synthetic peptide directed towards the N terminal of human CCNB3. Peptide sequence: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3 | |
Rabbit | |
291 kDa | |
20 μL | |
Cell Cycle and Replication | |
85417 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction