CCNY Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158071

Catalog No. NBP158071

Description

CCNY Polyclonal specifically detects CCNY in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCNY
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CBCP1C10orf9cyc-Y, CCNX, CFP 1, CFP1FLJ95513, chromosome 10 open reading frame 9, Cyclin box protein 1, Cyclin fold protein 1, cyclin Y, cyclin-box carrying protein 1, cyclin-X, cyclin-Y, Cyc-Y
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Rabbit: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8ND76
• Gene Symbols: CCNY
• Immunogen: Synthetic peptides corresponding to CCNY(cyclin Y) The peptide sequence was selected from the middle region of CCNY. Peptide sequence DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 219771
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.