Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCNY Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CCNY |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1580720
|
Novus Biologicals
NBP15807120UL |
20 μL |
Each for $152.22
|
|
NBP158071
|
Novus Biologicals
NBP158071 |
100 μL |
Each for $436.00
|
|
Description
CCNY Polyclonal specifically detects CCNY in Human samples. It is validated for Western Blot.Specifications
| CCNY | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| Q8ND76 | |
| 219771 | |
| Synthetic peptides corresponding to CCNY(cyclin Y) The peptide sequence was selected from the middle region of CCNY. Peptide sequence DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CBCP1C10orf9cyc-Y, CCNX, CFP 1, CFP1FLJ95513, chromosome 10 open reading frame 9, Cyclin box protein 1, Cyclin fold protein 1, cyclin Y, cyclin-box carrying protein 1, cyclin-X, cyclin-Y, Cyc-Y | |
| CCNY | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title