Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCZ1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310745100UL
Description
CCZ1 Polyclonal specifically detects CCZ1 in Human samples. It is validated for Western Blot.Specifications
CCZ1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C7orf28A, C7orf28B, CCZ1 vacuolar protein trafficking and biogenesis associated homolog (S. cerevisiae), CCZ1 vacuolar protein trafficking and biogenesis associated homolog B (S. cerevisiae), CCZ1A, CGI-43, chromosome 7 open reading frame 28B, FLJ60592, H_DJ1163J12.2, H_NH0577018.2, MGC19819, vacuolar fusion protein CCZ1 homolog-like | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCZ1 (NP_932765). Peptide sequence PEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMY | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
51622 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction