Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD117/c-kit Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP257890

Catalog No. NBP257890

Add to cart



CD117/c-kit Polyclonal antibody specifically detects CD117/c-kit in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.


PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
CD117, CD117 antigen, ckit, C-Kit, EC 2.7.10, EC, PBT, piebald trait, Proto-oncogene c-Kit, proto-oncogene tyrosine-protein kinase Kit, SCFRmast/stem cell growth factor receptor, soluble KIT variant 1, Tyrosine-protein kinase Kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein
100 ul
B Cell Development and Differentiation Markers, Cancer, Cancer Stem Cells, Cellular Markers, Cytokine Research, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid derived Suppressor Cell, Protein Kinase, Signal Transduction, Stem Cell Markers, Tyrosine Kinases
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
Affinity purified
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only