Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD19 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Supplier:  Thermo Scientific PA595326

Catalog No. PIPA595326


Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

CD19 is a member of the immunoglobulin superfamily and has two Ig like domains. The CD19 molecule is expressed on 100% of the peripheral B cells as defined by expression of kappa or lambda light chains. CD19 appears to be expressed on myeloid leukemia cells, particularly those of monocytic lineage. Leukemia phenotype studies have demonstrated that the earliest and broadest B cell restricted antigen is the CD19 antigen. The receptor for CD19 is an important functional regulator of normal and malignant B cell proliferation, and is expressed in all B cell precursor leukemias. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. CD19 is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Besides being a signal-amplifying coreceptor for the B cell receptor (BCR), CD19 can also signal independently of BCR co-ligation and is a central regulatory component upon which multiple signaling pathways converge. Mutation of the CD19 gene results in hypogammaglobulinemia, whereas CD19 overexpression causes B cell hyperactivity.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

CD19
Polyclonal
Unconjugated
Cd19
AW495831, B4, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Cd19, CD19 antigen, CD19 molecule, CVID3, differentiation antigen CD19, Leu-12, T-cell surface antigen Leu-12
Rabbit
Affinity chromatography
RUO
930
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Lyophilized
Immunohistochemistry (Paraffin), Western Blot
500 μg/mL
PBS with 5MG BSA and 0.05MG sodium azide
P15391
Cd19
A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT).
100 μg
Primary
Human
Antibody
IgG
Product Suggestions

Product Suggestions

Safety and Handling

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit