CD19 Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Supplier:  Thermo Scientific PA595326

Catalog No. PIPA595326

Description

Synthetic peptide sequence: 307-337aa, LVGILHLQRALVLRRKRKRMTDPTRRFFKVT. Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

CD19 is a member of the immunoglobulin superfamily and has two Ig like domains. The CD19 molecule is expressed on 100% of the peripheral B cells as defined by expression of kappa or lambda light chains. CD19 appears to be expressed on myeloid leukemia cells, particularly those of monocytic lineage. Leukemia phenotype studies have demonstrated that the earliest and broadest B cell restricted antigen is the CD19 antigen. The receptor for CD19 is an important functional regulator of normal and maligt B cell proliferation, and is expressed in all B cell precursor leukemias. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. CD19 is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Besides being a signal-amplifying coreceptor for the B cell receptor (BCR), CD19 can also signal independently of BCR co-ligation and is a central regulatory component upon which multiple signaling pathways converge. Mutation of the CD19 gene results in hypogammaglobulinemia, whereas CD19 overexpression causes B cell hyperactivity.

Specifications

• Antigen: CD19
• Classification: Polyclonal
• Formulation: 0.2mg sodium phosphate with 0.9MG NaCl, 0.9MG NaCl, 5MG BSA, 5MG BSA and 0.05MG sodium azide, 0.05MG sodium azide
• Gene Accession No.: P15391
• Gene Symbols: CD19
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD19, different from the related mouse sequence by seven amino acids.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Conjugate: Unconjugated
• Gene: CD19
• Gene Alias: B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Differentiation antigen CD19; T-cell surface antigen Leu-12; CD19; CD19
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 930
• Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
• Form: Lyophilized