Invitrogen™ CD229 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595601

Catalog No. PIPA595601

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse spleen tissue, mouse spleen tissue, rat spleen tissue, rat spleen tissue. Flow: Jurkat cell, Daudi cell, U937 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

CD229 (Ly9) is a cell surface receptor of the CD150 family, which includes also e.g. CD48 and CD224. Receptors of this family regulate cytokine production and cytotoxicity of lymphocytes and NK cells. High levels of CD229 are found on T and B cells, where its expression increases during their maturation. It is absent on granulocytes, bone marrow-derived dendritic cells, platelets and erythrocytes. CD229 has been also reported on mouse monocytes and NK cells. CD229 interacts homophilically through its N-terminal domain and localizes to the contact site between T cells and antigen presenting B cells during antigen-dependent immune synapse formation.

Specifications

• Antigen: CD229
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Ly9
• Gene Alias: AI893573; CD229; CDABP0070; Cell surface molecule Ly-9; hly9; Lgp100; LY9; Ly-9; Lymphocyte antigen 9; mLY9; RP11-312J18.1; Signaling lymphocytic activation molecule 3; SLAM family member 3; SLAMF3; T100; T-lymphocyte surface antigen Ly-9
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 17085, 289227, 4063
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q01965, Q9HBG7
• Gene Symbols: Ly9
• Immunogen: A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov